General Information

  • ID:  hor003018
  • Uniprot ID:  P13205
  • Protein name:  Brain natriuretic peptide 45
  • Gene name:  Nppb
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  Up-regulated in cardiocytes in response to stretching for 48hr. |Expressed in the atria and ventricles throughout postnatal development and in adults. |Expressed in the atria and ventricles, but at much lower levels than NPPA .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0000165 MAPK cascade; GO:0001666 response to hypoxia; GO:0001935 endothelial cell proliferation; GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0006950 response to stress; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007507 heart development; GO:0007584 response to nutrient; GO:0009410 response to xenobiotic stimulus; GO:0010753 positive regulation of cGMP-mediated signaling; GO:0014070 response to organic cyclic compound; GO:0014898 cardiac muscle hypertrophy in response to stress; GO:0019934 cGMP-mediated signaling; GO:0030308 negative regulation of cell growth; GO:0031667 response to nutrient levels; GO:0032496 response to lipopolysaccharide; GO:0035810 positive regulation of urine volume; GO:0043434 response to peptide hormone; GO:0048662 negative regulation of smooth muscle cell proliferation; GO:0048872 homeostasis of number of cells; GO:0051592 response to calcium ion; GO:0060976 coronary vasculature development; GO:0061049 cell growth involved in cardiac muscle cell development; GO:0070482 response to oxygen levels; GO:0071260 cellular response to mechanical stimulus; GO:0097746 blood vessel diameter maintenance; GO:1903816 positive regulation of collecting lymphatic vessel constriction; GO:1904055 negative regulation of cholangiocyte proliferation; GO:1904681 response to 3-methylcholanthrene
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0032991 protein-containing complex; GO:0048471 perinuclear region of cytoplasm

Sequence Information

  • Sequence:  SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
  • Length:  45
  • Propeptide:  MDLQKVLPQMILLLLFLNLSPLGGHSHPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
  • Signal peptide:  MDLQKVLPQMILLLLFLNLSPLGGHS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npr1, Npr3
  • Target Unid:  P18910, P41740
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 45 (t1/2 alpha or initial phase t1/2) seconds; /45 seconds ( PubMed ID: 1664804 )

Structure

  • Disulfide bond:  23-39
  • Structure ID:  AF-Q8S8P7-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q8S8P7-F1.pdbhor003018_AF2.pdbhor003018_ESM.pdb

Physical Information

Mass: 582775 Formula: C213H351N71O65S3
Absent amino acids: PTWY Common amino acids: S
pI: 10.73 Basic residues: 9
Polar residues: 14 Hydrophobic residues: 14
Hydrophobicity: -43.56 Boman Index: -12379
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 73.78
Instability Index: 6501.56 Extinction Coefficient cystines: 125
Absorbance 280nm: 2.84

Literature

  • PubMed ID:  2528349
  • Title:  Isolation and Sequence Determination of Rat Cardiac Natriuretic Peptide.
  • PubMed ID:  2525380
  • Title:  Isolation and Characterization of iso-rANP, a New Natriuretic Peptide From Rat Atria
  • PubMed ID:  1664804
  • Title: